Products > Peptides
Benzyl Alcoh

Benzyl Alcoh

Benzyl Alcohol is an important aromatic alcohol widely used in medicine, daily chemicals, food, chemical industry and other fields. The following is a detailed introduction: I. Basic Information Molecular Formula: () Molecular Weight: 108.14 CAS No.: 100-51-6 Appearance and Odor: Colorless transparent liquid with a faint, pleasant aromatic odor Solubility: Slightly soluble in water (approximately 4.29 g/100 mL at 25⊥), readily soluble in organic solvents such as ethanol, ether, acetone and benzene II. Physicochemical Properties Property Value Melting Point -15.3⊥ Boiling Point 205.7⊥ Relative Density 1.045 g/mL (25⊥) Flash Point 100⊥ (open cup) Autoignition Temperature 436⊥ Explosion ...

Read more
Acetic Acid Water

Acetic Acid Water

Acetic Acid Water is an acidic solution formed by dissolving acetic acid in water. It is one of the most common weak acid systems and is widely used in food, cleaning, chemical, pharmaceutical and other fields. I. Basic Information Chemical Name: Aqueous Acetic Acid Solution Chemical Formula: (Solute: ; Solvent: ) Common Names: Dilute acetic acid, vinegar (food grade, concentration approx. 4%每8%) State: Colorless transparent liquid with a pungent vinegar-like odor Solubility: Acetic acid is miscible with water in any proportion Acidity: Weak acid; pH of a 1 mol/L solution > 2.4 II. Core Chemical Properties Weak Ionization Equilibrium It only partially dissociates in water, with a reversible equilibrium: Only about 0.4% of the molecules ionize, resulting in mild acidity and much lower corrosiveness than strong acids. Relationship Between pH and Concentration The higher the concentration, the lower the ...

Read more
Adipotide

Adipotide

Adipotide (also known as FTPP, Prohibitin‑TP01) is a synthetic peptide targeting apoptosis in adipose blood vessels. Its core function is to selectively cut off the blood supply to white adipose tissue and induce adipocyte apoptosis. At present, it is only used for scientific research purposes and has not been approved for clinical or human use. I. Basic Information Full name: Fat‑Targeted Proapoptotic Peptide Aliases: Prohibitin‑TP01, weight‑loss peptide / adipose peptide R&D background: Developed by the MD Anderson Cancer Center in the United States in 2004, initially extending the tumor blood vessel targeting strategy to obesity research Molecular structure: Chimeric peptide, composed of two parts linked by glycine (GG) Targeting region: CKGGRAKDC (recognizes the Prohibitin receptor on adipose vascular endothelium) Pro‑apoptotic region: D(KLAKLAK)₂ (triggers programmed death of vascular endothelial cells) Molecular formula: C₁₁₁H₂₀₆N₃₆OS ...

Read more
BENZYL ALCOHOL

BENZYL ALCOHOL

BENZYL ALCOHOL is an important aromatic alcohol widely used in pharmaceutical, daily chemical, food and industrial fields, renowned for its strong polarity, low toxicity and good solubility. Basic Information Molecular Formula: () Molecular Weight: 108.14 CAS No.: 100-51-6 Synonyms: Benzyl alcohol, 汐-hydroxytoluene, phenylmethanol Physical Properties Appearance: Colorless transparent liquid with a faint aromatic odor Melting Point: -15.3⊥ Boiling Point: 205.3⊥ Density: 1.045 g/mL (25⊥) Solubility: Slightly soluble in water (4.29 g/100 mL, 20⊥), miscible with organic solvents such as ethanol, ether, acetone and benzene Flash Point: 100⊥ (closed cup) Vapor Pressure: 0.13 kPa (58⊥) Chemical Properties Oxidation Reaction: Easily oxidized to benzaldehyde and further to benzoic acid Esterification Reaction: Reacts with organic acids to form benzyl esters, which are important intermediates for fragrances and plasticizers Halogenation Reaction: Reacts with hydrohalic acids and phosphorus halides to ...

Read more
Glutathione

Glutathione

Glutathione (GSH) is the most central and abundant endogenous antioxidant and detoxifying molecule in human cells, composed of glutamic acid, cysteine, and glycine, with its core activity derived from the sulfhydryl group (-SH). I. Basic Structure and Forms Chemical Nature: 污-L-glutamyl-L-cysteinyl-glycine (污-Glu-Cys-Gly), containing a 污-amide bond and a sulfhydryl group (-SH), with a molecular weight of approximately 307. Two Forms: Reduced Glutathione (GSH): The active form, accounting for more than 90% of the total intracellular content. Oxidized Glutathione (GSSG): A dimer formed after GSH is oxidized, which can be reduced and regenerated by glutathione reductase. Distribution: Present in almost all living cells, with the highest concentration in the liver, followed by the kidneys, red blood cells, eyes, and other tissues. II. Core Physiological Functions Potent Antioxidation (Core Function) Direct free radical scavenging: The sulfhydryl group (-SH) donates electrons to neutralize superoxide anions, hydroxyl radicals, and lipid peroxides, protecting cell membranes, proteins, and DNA from oxidative damage. ...

Read more
Insulin

Insulin

Insulin is the only peptide hormone secreted by pancreatic 汕-cells in the human body that directly lowers blood glucose, and it is also a core drug for the treatment of diabetes. I. Basic Structure and Origin Structure : Composed of an A-chain (21 amino acids) and a B-chain (30 amino acids) linked by two disulfide bonds, with a total of 51 amino acid residues. Synthesis : Within pancreatic islet 汕-cells, preproinsulin is first synthesized, which is cleaved to form proinsulin, and then enzymatically digested into insulin and C-peptide (C-peptide can reflect the level of endogenous insulin secretion). Nomenclature : Derived from the Latin word insula (island), as it is secreted by the islets of Langerhans. II. Core Physiological Functions Insulin is the major anabolic hormone in the body, regulating the metabolism of the three major nutrients: Glucose Metabolism (Blood Glucose Lowering) Promotes glucose uptake by muscle, adipose tissue, and the liver. Stimulate ...

Read more
HGH 191AA

HGH 191AA

HGH 191AA (Somatropin, Recombinant Human Growth Hormone) is a single-chain polypeptide consisting of 191 amino acids with an identical amino acid sequence to the naturally secreted human growth hormone. It is currently the most mainstream growth hormone preparation in clinical and scientific research, with a structure closest to the physiological one. I. Basic Information Full Name: Human Growth Hormone 191 Amino Acids Aliases: Somatropin, rhGH, hGH-N Structure: Single-chain non-glycosylated polypeptide containing 191 amino acids, with a molecular weight of approximately 22 kDa and 2 intramolecular disulfide bonds Source: Expressed and produced in Escherichia coli (E. coli) via genetic recombination technology Nature: Identical in structure and function to the natural growth hormone secreted by the anterior pituitary gland in humans II. Core Mechanism of Action HGH 191AA exerts its effects through two pathways: direct action and indirect action (mediated by IGF-1): Direct Act ...

Read more
IGF‑1 LR3

IGF‑1 LR3

IGF‑1 LR3 (Long‑Arg³‑IGF‑1) is a synthetic long‑acting insulin‑like growth factor‑1 analog. Its structural modification has significantly enhanced its biological activity and duration of action. It is mainly used in scientific research and cell culture, and has not been approved for human clinical use. Basic Structure and Modifications Full Name: Long‑Arginine³‑Insulin‑Like Growth Factor‑1 Number of amino acids: 83 (native IGF‑1 has 70) Key Modifications R3 substitution: Glutamic acid (Glu) at position 3 ↙ Arginine (Arg), reducing affinity for IGF‑binding proteins (IGFBPs) by approximately 500‑fold. N‑terminal extension: 13 additional amino acids (MFPAMPLLSLFVN) at the N‑terminus, improving metabolic stability and extending half‑life. ...

Read more
Hyaluronic Acid

Hyaluronic Acid

Hyaluronic Acid (HA, also known as hyaluronan; sodium hyaluronate in medicinal applications), covering its structure, sources, physiological functions, core applications, and molecular weight classification, suitable for product R&D and marketing scenarios. I. Basic Definition and Chemical Structure Nature : An anionic, non-sulfated glycosaminoglycan (GAG), a linear high-molecular-weight polysaccharide formed by the alternating linkage of D-glucuronic acid and N-acetyl-D-glucosamine via 汕-1,3 and 汕-1,4 glycosidic bonds, with the molecular formula (C₁₄H₂₁NO₁₁)ₙ. It is an odorless, tasteless, white amorphous solid with high water solubility, and its aqueous solution exhibits viscoelasticity. Discovery History : First discovered in the vitreous humor of rabbit eyes in 1880; formally isolated and named by Meyer and Palmer in 1934. Unlike most GAGs, HA is synthesized in the cell membrane rather than the Golgi apparatus and does not bind to core proteins. Molecular Weight Range : Ranges from several thousand Da to 10⁷ ...

Read more
Kisspeptin

Kisspeptin

Kisspeptin is a core neuropeptide that regulates the reproductive system and serves as the "master switch" of the hypothalamic-pituitary-gonadal (HPG) axis. It also exhibits functions such as inhibiting tumor metastasis and regulating cardiovascular and metabolic activities. I. Basic Information Discovery and Naming Discovered in Hershey, Pennsylvania, USA in 1996, the gene was named KISS1 in tribute to the local Hershey's Kisses chocolate. Initially named Metastin for its ability to suppress tumor metastasis, it later became widely known as Kisspeptin due to its central role in reproductive regulation. Gene and Structure Encoded by the KISS1 gene (human chromosome 1q32), it is translated into a 145-amino-acid precursor, which is hydrolyzed into KP‑54 (the main active form), KP‑14, KP‑13, and KP‑10. Collectively referred to as Kisspeptin, all isoforms contain a conserved C-terminal Arg‑Phe‑NH₂, a structure essential for receptor binding. Receptor KISS1 ...

Read more
PNC‑27

PNC‑27

PNC‑27 is a chimeric anticancer cell-penetrating peptide. Its core characteristic is the selective recognition of HDM‑2 on cancer cell membranes, rapid formation of membrane pores leading to cancer cell necrosis, with almost no damage to normal cells. I. Basic Information CAS Number: 1159861‑00‑3 Molecular Weight: Approximately 4.2 kDa Structure: Composed of two fused segments: N-terminus: Amino acids 12每26 of the p53 protein (HDM‑2 binding domain) C-terminus: Transmembrane domain of penetratin Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG II. Mechanism of Action (Core) PNC‑27 targets membrane-bound HDM‑2 and rapidly kills cancer cells through a three-step process: "recognition‑pore formation‑cell lysis": Targeted Binding Membrane-bound HDM‑2 is highly expressed on cancer cell membranes, while barely present on normal cell membranes. PNC‑27 specifically binds to membrane HDM‑2 via its N-terminal p53 domain and accumulates on cancer cell membranes within 15 minutes. Conformational Change and Pore Formation Upon binding, PNC ...

Read more
Sermorelin

Sermorelin

Sermorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH). Its core function is to stimulate the pituitary gland to secrete endogenous growth hormone (GH), and it was once used in the diagnosis and treatment of growth hormone deficiency in children. I. Basic Information Chemical Nature: A polypeptide consisting of 29 amino acids, corresponding to the 1每29 active core fragment of human natural GHRH (44-amino acid peptide), also known as GHRH(1每29) or GRF(1每29). Original Brand Names: Geref, Gerel. Administration Route: Subcutaneous injection. Pharmacokinetics: Short half-life (10每20 minutes when administered intravenously), with pulsatile action that is more in line with physiological rhythms. II. Mechanism of Action Receptor Activation: Binds to GHRH receptors on pituitary somatotrophs, initiates the cAMP每PKA signaling pathway, and promotes GH gene transcription and the release of secretory granules. Physiological Pulsatility: Regulated by the negativ ...

Read more

Total:3 page, with 35 products